PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.318610.1
Common NameCsa_2G439230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 301aa    MW: 34108.4 Da    PI: 6.5082
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.318610.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++++G g+W++ ++  g++R++k+c++rw +yl
   Cucsa.318610.1 15 KGPWTPEEDRKLVDYIEKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding52.41.2e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E+++++++++ lG++ W+ Ia++++ gRt++++k++w+++l
   Cucsa.318610.1  68 RGNFSDQEEQIIINLHASLGNK-WSIIASHLP-GRTDNEIKNFWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.9061062IPR017930Myb domain
SuperFamilySSF466896.74E-3212109IPR009057Homeodomain-like
SMARTSM007174.1E-161464IPR001005SANT/Myb domain
PfamPF002496.2E-181562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-251669IPR009057Homeodomain-like
CDDcd001671.07E-121762No hitNo description
PROSITE profilePS5129426.763117IPR017930Myb domain
SMARTSM007172.0E-1667115IPR001005SANT/Myb domain
PfamPF002493.5E-1568113IPR001005SANT/Myb domain
CDDcd001671.49E-1170113No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MFGRSPTPEE NGVKKGPWTP EEDRKLVDYI EKHGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGN FSDQEEQIII NLHASLGNKW SIIASHLPGR TDNEIKNFWN THLKKKLLQM  120
GIDPVTHMPI TDRHHLNTLS NLHHLLSLHT SPWDNPLRLQ NDATQLAKAQ LLQNLLQLLA  180
SQSSLSISNN NLFNTQQILD LNYNLPIGSF FQNIPINIEP PQGPLSCDDY TAATDGALGF  240
ENDNDRIKTF YDMNQRLNSL PNLIPASPEC SKIPTAIENN WDDDLMDVEA SDSSWKHVIE  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28151177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819140.0LN681914.1 Cucumis melo genomic scaffold, anchoredscaffold00050.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011650084.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0A0LND60.0A0A0A0LND6_CUCSA; Uncharacterized protein
STRINGVIT_16s0039g01710.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-77myb domain protein 93
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]